Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for 4j rgzh biology 21. 4j rgzh biology 1 pt. 8,047
  2. Avatar for Deleted group 22. Deleted group pts. 7,822
  3. Avatar for CureCoin 23. CureCoin 1 pt. 7,780
  4. Avatar for EricHamber 24. EricHamber 1 pt. 7,733
  5. Avatar for freefolder 25. freefolder 1 pt. 7,553
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,345
  7. Avatar for test_group1 27. test_group1 1 pt. 5,718
  1. Avatar for Mohambone 161. Mohambone Lv 1 1 pt. 8,514
  2. Avatar for yiminjune 162. yiminjune Lv 1 1 pt. 8,512
  3. Avatar for lamoille 163. lamoille Lv 1 1 pt. 8,500
  4. Avatar for 20515872 164. 20515872 Lv 1 1 pt. 8,489
  5. Avatar for 01010011111 165. 01010011111 Lv 1 1 pt. 8,468
  6. Avatar for lightnir 166. lightnir Lv 1 1 pt. 8,468
  7. Avatar for dnpw1 167. dnpw1 Lv 1 1 pt. 8,444
  8. Avatar for PrettyPony2001 168. PrettyPony2001 Lv 1 1 pt. 8,442
  9. Avatar for Punktchen 169. Punktchen Lv 1 1 pt. 8,435
  10. Avatar for cherry39 170. cherry39 Lv 1 1 pt. 8,418

Comments