Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for 4j rgzh biology 21. 4j rgzh biology 1 pt. 8,047
  2. Avatar for Deleted group 22. Deleted group pts. 7,822
  3. Avatar for CureCoin 23. CureCoin 1 pt. 7,780
  4. Avatar for EricHamber 24. EricHamber 1 pt. 7,733
  5. Avatar for freefolder 25. freefolder 1 pt. 7,553
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,345
  7. Avatar for test_group1 27. test_group1 1 pt. 5,718
  1. Avatar for Arne Heessels 181. Arne Heessels Lv 1 1 pt. 8,326
  2. Avatar for brgreening 182. brgreening Lv 1 1 pt. 8,292
  3. Avatar for Inkedhands 183. Inkedhands Lv 1 1 pt. 8,283
  4. Avatar for justjustin 184. justjustin Lv 1 1 pt. 8,219
  5. Avatar for asekora 185. asekora Lv 1 1 pt. 8,197
  6. Avatar for AlexMbpsd15 186. AlexMbpsd15 Lv 1 1 pt. 8,193
  7. Avatar for Scopper 187. Scopper Lv 1 1 pt. 8,168
  8. Avatar for Blitzghost 188. Blitzghost Lv 1 1 pt. 8,168
  9. Avatar for ivalnic 189. ivalnic Lv 1 1 pt. 8,143
  10. Avatar for trebach 190. trebach Lv 1 1 pt. 8,131

Comments