Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for 4j rgzh biology 21. 4j rgzh biology 1 pt. 8,047
  2. Avatar for Deleted group 22. Deleted group pts. 7,822
  3. Avatar for CureCoin 23. CureCoin 1 pt. 7,780
  4. Avatar for EricHamber 24. EricHamber 1 pt. 7,733
  5. Avatar for freefolder 25. freefolder 1 pt. 7,553
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,345
  7. Avatar for test_group1 27. test_group1 1 pt. 5,718
  1. Avatar for gitwut 11. gitwut Lv 1 83 pts. 9,252
  2. Avatar for nemo7731 12. nemo7731 Lv 1 81 pts. 9,226
  3. Avatar for johnmitch 13. johnmitch Lv 1 80 pts. 9,214
  4. Avatar for KarenCH 14. KarenCH Lv 1 78 pts. 9,213
  5. Avatar for grogar7 15. grogar7 Lv 1 77 pts. 9,213
  6. Avatar for Museka 16. Museka Lv 1 75 pts. 9,211
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 74 pts. 9,211
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 72 pts. 9,210
  9. Avatar for Skippysk8s 19. Skippysk8s Lv 1 71 pts. 9,203
  10. Avatar for gmn 20. gmn Lv 1 69 pts. 9,200

Comments