Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for 4j rgzh biology 21. 4j rgzh biology 1 pt. 8,047
  2. Avatar for Deleted group 22. Deleted group pts. 7,822
  3. Avatar for CureCoin 23. CureCoin 1 pt. 7,780
  4. Avatar for EricHamber 24. EricHamber 1 pt. 7,733
  5. Avatar for freefolder 25. freefolder 1 pt. 7,553
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,345
  7. Avatar for test_group1 27. test_group1 1 pt. 5,718
  1. Avatar for Wrath of Dan 211. Wrath of Dan Lv 1 1 pt. 7,969
  2. Avatar for franse 212. franse Lv 1 1 pt. 7,964
  3. Avatar for 20514392 213. 20514392 Lv 1 1 pt. 7,961
  4. Avatar for akakebeen 214. akakebeen Lv 1 1 pt. 7,959
  5. Avatar for chillprod 215. chillprod Lv 1 1 pt. 7,944
  6. Avatar for akii 216. akii Lv 1 1 pt. 7,940
  7. Avatar for subtlefox 217. subtlefox Lv 1 1 pt. 7,932
  8. Avatar for Carter J. Madsen 218. Carter J. Madsen Lv 1 1 pt. 7,926
  9. Avatar for cnhrcolemam 219. cnhrcolemam Lv 1 1 pt. 7,894
  10. Avatar for SarahSoward 220. SarahSoward Lv 1 1 pt. 7,889

Comments