Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for 4j rgzh biology 21. 4j rgzh biology 1 pt. 8,047
  2. Avatar for Deleted group 22. Deleted group pts. 7,822
  3. Avatar for CureCoin 23. CureCoin 1 pt. 7,780
  4. Avatar for EricHamber 24. EricHamber 1 pt. 7,733
  5. Avatar for freefolder 25. freefolder 1 pt. 7,553
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,345
  7. Avatar for test_group1 27. test_group1 1 pt. 5,718
  1. Avatar for diamond_dust 21. diamond_dust Lv 1 68 pts. 9,198
  2. Avatar for bertro 22. bertro Lv 1 67 pts. 9,196
  3. Avatar for aznarog 23. aznarog Lv 1 65 pts. 9,194
  4. Avatar for Timo van der Laan 24. Timo van der Laan Lv 1 64 pts. 9,191
  5. Avatar for O Seki To 25. O Seki To Lv 1 63 pts. 9,186
  6. Avatar for Deleted player 26. Deleted player pts. 9,183
  7. Avatar for smilingone 27. smilingone Lv 1 60 pts. 9,178
  8. Avatar for nicobul 28. nicobul Lv 1 59 pts. 9,171
  9. Avatar for strong_base 29. strong_base Lv 1 58 pts. 9,165
  10. Avatar for Deleted player 30. Deleted player 57 pts. 9,164

Comments