Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for 4j rgzh biology 21. 4j rgzh biology 1 pt. 8,047
  2. Avatar for Deleted group 22. Deleted group pts. 7,822
  3. Avatar for CureCoin 23. CureCoin 1 pt. 7,780
  4. Avatar for EricHamber 24. EricHamber 1 pt. 7,733
  5. Avatar for freefolder 25. freefolder 1 pt. 7,553
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,345
  7. Avatar for test_group1 27. test_group1 1 pt. 5,718
  1. Avatar for g_b 31. g_b Lv 1 55 pts. 9,159
  2. Avatar for Jim Fraser 32. Jim Fraser Lv 1 54 pts. 9,149
  3. Avatar for Vredeman 33. Vredeman Lv 1 53 pts. 9,147
  4. Avatar for greepski 34. greepski Lv 1 52 pts. 9,144
  5. Avatar for martin.szew 35. martin.szew Lv 1 51 pts. 9,139
  6. Avatar for SKSbell 36. SKSbell Lv 1 50 pts. 9,138
  7. Avatar for TomTaylor 37. TomTaylor Lv 1 49 pts. 9,132
  8. Avatar for pmdpmd 38. pmdpmd Lv 1 48 pts. 9,126
  9. Avatar for Merf 39. Merf Lv 1 47 pts. 9,123
  10. Avatar for cbwest 40. cbwest Lv 1 46 pts. 9,122

Comments