Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for 4j rgzh biology 21. 4j rgzh biology 1 pt. 8,047
  2. Avatar for Deleted group 22. Deleted group pts. 7,822
  3. Avatar for CureCoin 23. CureCoin 1 pt. 7,780
  4. Avatar for EricHamber 24. EricHamber 1 pt. 7,733
  5. Avatar for freefolder 25. freefolder 1 pt. 7,553
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,345
  7. Avatar for test_group1 27. test_group1 1 pt. 5,718
  1. Avatar for WarpSpeed 51. WarpSpeed Lv 1 36 pts. 9,091
  2. Avatar for jamiexq 52. jamiexq Lv 1 35 pts. 9,083
  3. Avatar for goastano 53. goastano Lv 1 34 pts. 9,077
  4. Avatar for sheerbliss 54. sheerbliss Lv 1 33 pts. 9,075
  5. Avatar for Anfinsen_slept_here 55. Anfinsen_slept_here Lv 1 33 pts. 9,071
  6. Avatar for dettingen 56. dettingen Lv 1 32 pts. 9,071
  7. Avatar for harvardman 57. harvardman Lv 1 31 pts. 9,064
  8. Avatar for t012 58. t012 Lv 1 30 pts. 9,058
  9. Avatar for jobo0502 59. jobo0502 Lv 1 30 pts. 9,056
  10. Avatar for viosca 60. viosca Lv 1 29 pts. 9,055

Comments