Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,366
  2. Avatar for Go Science 2. Go Science 83 pts. 9,328
  3. Avatar for Beta Folders 3. Beta Folders 68 pts. 9,318
  4. Avatar for Gargleblasters 4. Gargleblasters 55 pts. 9,312
  5. Avatar for Contenders 5. Contenders 44 pts. 9,252
  6. Avatar for HMT heritage 6. HMT heritage 35 pts. 9,212
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 9,211
  8. Avatar for Void Crushers 8. Void Crushers 21 pts. 9,191
  9. Avatar for Deleted group 9. Deleted group pts. 9,079
  10. Avatar for BOINC@Poland 10. BOINC@Poland 12 pts. 9,037
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,366
  2. Avatar for MaartenDesnouck 2. MaartenDesnouck Lv 1 88 pts. 9,353
  3. Avatar for jamiexq 3. jamiexq Lv 1 77 pts. 9,351
  4. Avatar for gmn 4. gmn Lv 1 68 pts. 9,349
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 59 pts. 9,328
  6. Avatar for diamond_dust 6. diamond_dust Lv 1 51 pts. 9,326
  7. Avatar for pauldunn 7. pauldunn Lv 1 44 pts. 9,324
  8. Avatar for gloverd 8. gloverd Lv 1 38 pts. 9,323
  9. Avatar for mirp 9. mirp Lv 1 32 pts. 9,320
  10. Avatar for dettingen 10. dettingen Lv 1 27 pts. 9,319

Comments