Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,366
  2. Avatar for Go Science 2. Go Science 83 pts. 9,328
  3. Avatar for Beta Folders 3. Beta Folders 68 pts. 9,318
  4. Avatar for Gargleblasters 4. Gargleblasters 55 pts. 9,312
  5. Avatar for Contenders 5. Contenders 44 pts. 9,252
  6. Avatar for HMT heritage 6. HMT heritage 35 pts. 9,212
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 9,211
  8. Avatar for Void Crushers 8. Void Crushers 21 pts. 9,191
  9. Avatar for Deleted group 9. Deleted group pts. 9,079
  10. Avatar for BOINC@Poland 10. BOINC@Poland 12 pts. 9,037

  1. Avatar for alwen 21. alwen Lv 1 3 pts. 9,307
  2. Avatar for Tweedle Dumb 22. Tweedle Dumb Lv 1 3 pts. 9,307
  3. Avatar for Deleted player 23. Deleted player 2 pts. 9,306
  4. Avatar for Norrjane 24. Norrjane Lv 1 2 pts. 9,304
  5. Avatar for Skippysk8s 25. Skippysk8s Lv 1 1 pt. 9,304
  6. Avatar for dbuske 26. dbuske Lv 1 1 pt. 9,303
  7. Avatar for sheerbliss 27. sheerbliss Lv 1 1 pt. 9,299
  8. Avatar for ManVsYard 28. ManVsYard Lv 1 1 pt. 9,294
  9. Avatar for phi16 29. phi16 Lv 1 1 pt. 9,285
  10. Avatar for gitwut 30. gitwut Lv 1 1 pt. 9,248

Comments