Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,366
  2. Avatar for Go Science 2. Go Science 83 pts. 9,328
  3. Avatar for Beta Folders 3. Beta Folders 68 pts. 9,318
  4. Avatar for Gargleblasters 4. Gargleblasters 55 pts. 9,312
  5. Avatar for Contenders 5. Contenders 44 pts. 9,252
  6. Avatar for HMT heritage 6. HMT heritage 35 pts. 9,212
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 9,211
  8. Avatar for Void Crushers 8. Void Crushers 21 pts. 9,191
  9. Avatar for Deleted group 9. Deleted group pts. 9,079
  10. Avatar for BOINC@Poland 10. BOINC@Poland 12 pts. 9,037

  1. Avatar for BitSpawn
    1. BitSpawn Lv 1
    100 pts. 9,364
  2. Avatar for mirp 2. mirp Lv 1 99 pts. 9,325
  3. Avatar for frood66 3. frood66 Lv 1 97 pts. 9,301
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 95 pts. 9,300
  5. Avatar for Galaxie 5. Galaxie Lv 1 93 pts. 9,299
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 91 pts. 9,294
  7. Avatar for LociOiling 7. LociOiling Lv 1 90 pts. 9,279
  8. Avatar for Blipperman 8. Blipperman Lv 1 88 pts. 9,278
  9. Avatar for gloverd 9. gloverd Lv 1 86 pts. 9,277
  10. Avatar for pauldunn 10. pauldunn Lv 1 85 pts. 9,269

Comments