Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for It's over 9000! 11. It's over 9000! 7 pts. 8,702
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 5 pts. 8,635
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,609
  4. Avatar for Natural Abilities 14. Natural Abilities 3 pts. 8,602
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 2 pts. 8,550
  6. Avatar for xkcd 16. xkcd 1 pt. 8,549
  7. Avatar for Deleted group 18. Deleted group pts. 8,384
  8. Avatar for CureCoin 19. CureCoin 1 pt. 8,376
  9. Avatar for EVHS AP Biology 20. EVHS AP Biology 1 pt. 8,366

  1. Avatar for deLaCeiba 101. deLaCeiba Lv 1 12 pts. 8,721
  2. Avatar for Colostomy EXPLOSION. 102. Colostomy EXPLOSION. Lv 1 11 pts. 8,720
  3. Avatar for Czim 103. Czim Lv 1 11 pts. 8,719
  4. Avatar for senor pit 104. senor pit Lv 1 11 pts. 8,718
  5. Avatar for strong_base 105. strong_base Lv 1 10 pts. 8,715
  6. Avatar for PrettyPony2001 106. PrettyPony2001 Lv 1 10 pts. 8,715
  7. Avatar for Maru67 107. Maru67 Lv 1 10 pts. 8,713
  8. Avatar for dettingen 108. dettingen Lv 1 10 pts. 8,711
  9. Avatar for arginia 109. arginia Lv 1 9 pts. 8,710
  10. Avatar for Psych0Active 110. Psych0Active Lv 1 9 pts. 8,708

Comments