Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for It's over 9000! 11. It's over 9000! 7 pts. 8,702
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 5 pts. 8,635
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,609
  4. Avatar for Natural Abilities 14. Natural Abilities 3 pts. 8,602
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 2 pts. 8,550
  6. Avatar for xkcd 16. xkcd 1 pt. 8,549
  7. Avatar for Deleted group 18. Deleted group pts. 8,384
  8. Avatar for CureCoin 19. CureCoin 1 pt. 8,376
  9. Avatar for EVHS AP Biology 20. EVHS AP Biology 1 pt. 8,366

  1. Avatar for Mohambone 141. Mohambone Lv 1 4 pts. 8,652
  2. Avatar for phi16 142. phi16 Lv 1 4 pts. 8,649
  3. Avatar for spirogyra 143. spirogyra Lv 1 3 pts. 8,646
  4. Avatar for kobasabu 144. kobasabu Lv 1 3 pts. 8,645
  5. Avatar for drumpeter18yrs9yrs 145. drumpeter18yrs9yrs Lv 1 3 pts. 8,645
  6. Avatar for Deleted player 146. Deleted player pts. 8,645
  7. Avatar for lamoille 147. lamoille Lv 1 3 pts. 8,637
  8. Avatar for Petrifolder 148. Petrifolder Lv 1 3 pts. 8,637
  9. Avatar for Olascoaga 149. Olascoaga Lv 1 3 pts. 8,637
  10. Avatar for stalluri 150. stalluri Lv 1 3 pts. 8,635

Comments