Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for It's over 9000! 11. It's over 9000! 7 pts. 8,702
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 5 pts. 8,635
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,609
  4. Avatar for Natural Abilities 14. Natural Abilities 3 pts. 8,602
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 2 pts. 8,550
  6. Avatar for xkcd 16. xkcd 1 pt. 8,549
  7. Avatar for Deleted group 18. Deleted group pts. 8,384
  8. Avatar for CureCoin 19. CureCoin 1 pt. 8,376
  9. Avatar for EVHS AP Biology 20. EVHS AP Biology 1 pt. 8,366

  1. Avatar for Kamil 9288 231. Kamil 9288 Lv 1 1 pt. 8,384
  2. Avatar for smarthuman 232. smarthuman Lv 1 1 pt. 8,376
  3. Avatar for MatthewAcosta 233. MatthewAcosta Lv 1 1 pt. 8,366
  4. Avatar for csowens0 234. csowens0 Lv 1 1 pt. 8,359
  5. Avatar for robertomedina 236. robertomedina Lv 1 1 pt. 8,336
  6. Avatar for Jerebear 237. Jerebear Lv 1 1 pt. 8,334
  7. Avatar for Nero93 238. Nero93 Lv 1 1 pt. 8,332
  8. Avatar for Close At Hand 239. Close At Hand Lv 1 1 pt. 8,329

Comments