Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,359
  2. Avatar for AST Biology 22. AST Biology 1 pt. 8,336
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,291
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 7,942
  5. Avatar for BiomedSHS 25. BiomedSHS 1 pt. 7,916

  1. Avatar for reefyrob
    1. reefyrob Lv 1
    100 pts. 8,918
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 99 pts. 8,914
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 97 pts. 8,912
  4. Avatar for mirp 4. mirp Lv 1 95 pts. 8,912
  5. Avatar for Timo van der Laan 5. Timo van der Laan Lv 1 94 pts. 8,910
  6. Avatar for hpaege 6. hpaege Lv 1 92 pts. 8,907
  7. Avatar for egran48 7. egran48 Lv 1 90 pts. 8,906
  8. Avatar for BitSpawn 8. BitSpawn Lv 1 89 pts. 8,900
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 87 pts. 8,899
  10. Avatar for bertro 10. bertro Lv 1 85 pts. 8,896

Comments