Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 8,919
  2. Avatar for Go Science 2. Go Science 81 pts. 8,915
  3. Avatar for Void Crushers 3. Void Crushers 65 pts. 8,910
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 52 pts. 8,906
  5. Avatar for Gargleblasters 5. Gargleblasters 41 pts. 8,896
  6. Avatar for Italiani Al Lavoro 6. Italiani Al Lavoro 32 pts. 8,880
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,870
  8. Avatar for HMT heritage 8. HMT heritage 18 pts. 8,866
  9. Avatar for Contenders 9. Contenders 14 pts. 8,859
  10. Avatar for Deleted group 10. Deleted group pts. 8,824
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 8,919
  2. Avatar for smilingone 2. smilingone Lv 1 89 pts. 8,917
  3. Avatar for gloverd 3. gloverd Lv 1 78 pts. 8,915
  4. Avatar for reefyrob 4. reefyrob Lv 1 68 pts. 8,915
  5. Avatar for Deleted player 5. Deleted player 60 pts. 8,914
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 52 pts. 8,913
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 45 pts. 8,912
  8. Avatar for Deleted player 8. Deleted player pts. 8,912
  9. Avatar for diamond_dust 9. diamond_dust Lv 1 33 pts. 8,911
  10. Avatar for mirp 10. mirp Lv 1 28 pts. 8,910

Comments