Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Beta Folders 100 pts. 8,919
  2. Avatar for Go Science 2. Go Science 81 pts. 8,915
  3. Avatar for Void Crushers 3. Void Crushers 65 pts. 8,910
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 52 pts. 8,906
  5. Avatar for Gargleblasters 5. Gargleblasters 41 pts. 8,896
  6. Avatar for Italiani Al Lavoro 6. Italiani Al Lavoro 32 pts. 8,880
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,870
  8. Avatar for HMT heritage 8. HMT heritage 18 pts. 8,866
  9. Avatar for Contenders 9. Contenders 14 pts. 8,859
  10. Avatar for Deleted group 10. Deleted group pts. 8,824

  1. Avatar for Tsskyx 161. Tsskyx Lv 1 2 pts. 8,617
  2. Avatar for anderssundin 162. anderssundin Lv 1 2 pts. 8,616
  3. Avatar for bwkittitas 163. bwkittitas Lv 1 2 pts. 8,615
  4. Avatar for JackONeill12 164. JackONeill12 Lv 1 2 pts. 8,613
  5. Avatar for kitek314_pl 165. kitek314_pl Lv 1 2 pts. 8,609
  6. Avatar for Misterioso 166. Misterioso Lv 1 2 pts. 8,608
  7. Avatar for SouperGenious 167. SouperGenious Lv 1 2 pts. 8,607
  8. Avatar for lol3droflxp 168. lol3droflxp Lv 1 2 pts. 8,606
  9. Avatar for rezaefar 169. rezaefar Lv 1 2 pts. 8,603
  10. Avatar for Mr_Jolty 170. Mr_Jolty Lv 1 2 pts. 8,602

Comments