Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Beta Folders 100 pts. 8,919
  2. Avatar for Go Science 2. Go Science 81 pts. 8,915
  3. Avatar for Void Crushers 3. Void Crushers 65 pts. 8,910
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 52 pts. 8,906
  5. Avatar for Gargleblasters 5. Gargleblasters 41 pts. 8,896
  6. Avatar for Italiani Al Lavoro 6. Italiani Al Lavoro 32 pts. 8,880
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,870
  8. Avatar for HMT heritage 8. HMT heritage 18 pts. 8,866
  9. Avatar for Contenders 9. Contenders 14 pts. 8,859
  10. Avatar for Deleted group 10. Deleted group pts. 8,824

  1. Avatar for Hana Hekal 261. Hana Hekal Lv 1 1 pt. 7,663
  2. Avatar for Posiedon2 262. Posiedon2 Lv 1 1 pt. 7,543
  3. Avatar for Vover 263. Vover Lv 1 1 pt. 7,523
  4. Avatar for OokamiJe 264. OokamiJe Lv 1 1 pt. 7,048
  5. Avatar for NachoTGamer 265. NachoTGamer Lv 1 1 pt. 7,022
  6. Avatar for DOREMI91 266. DOREMI91 Lv 1 1 pt. 7,012
  7. Avatar for ArturVS 267. ArturVS Lv 1 1 pt. 7,001
  8. Avatar for CallumGesthuien 268. CallumGesthuien Lv 1 1 pt. 6,240
  9. Avatar for kenny90 269. kenny90 Lv 1 1 pt. 6,230
  10. Avatar for Santor51 270. Santor51 Lv 1 1 pt. 5,923

Comments