Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Beta Folders 100 pts. 8,919
  2. Avatar for Go Science 2. Go Science 81 pts. 8,915
  3. Avatar for Void Crushers 3. Void Crushers 65 pts. 8,910
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 52 pts. 8,906
  5. Avatar for Gargleblasters 5. Gargleblasters 41 pts. 8,896
  6. Avatar for Italiani Al Lavoro 6. Italiani Al Lavoro 32 pts. 8,880
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,870
  8. Avatar for HMT heritage 8. HMT heritage 18 pts. 8,866
  9. Avatar for Contenders 9. Contenders 14 pts. 8,859
  10. Avatar for Deleted group 10. Deleted group pts. 8,824

  1. Avatar for WBarme1234 61. WBarme1234 Lv 1 31 pts. 8,806
  2. Avatar for Anfinsen_slept_here 62. Anfinsen_slept_here Lv 1 30 pts. 8,806
  3. Avatar for marie.p 63. marie.p Lv 1 29 pts. 8,805
  4. Avatar for pvc78 64. pvc78 Lv 1 29 pts. 8,801
  5. Avatar for manu8170 65. manu8170 Lv 1 28 pts. 8,799
  6. Avatar for g_b 66. g_b Lv 1 27 pts. 8,798
  7. Avatar for froggs554 67. froggs554 Lv 1 27 pts. 8,798
  8. Avatar for gurch 68. gurch Lv 1 26 pts. 8,797
  9. Avatar for inkycatz 69. inkycatz Lv 1 26 pts. 8,797
  10. Avatar for jamiexq 70. jamiexq Lv 1 25 pts. 8,795

Comments