Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 7 pts. 8,833
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,580
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 4 pts. 8,526
  4. Avatar for SETIKAH@KOREA 14. SETIKAH@KOREA 3 pts. 8,358
  5. Avatar for Natural Abilities 15. Natural Abilities 2 pts. 8,231
  6. Avatar for Deleted group 16. Deleted group pts. 7,695
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,337
  8. Avatar for Deleted group 18. Deleted group pts. 6,522
  9. Avatar for Desert Scientist 19. Desert Scientist 1 pt. 6,518
  10. Avatar for CureCoin 20. CureCoin 1 pt. 5,862
  1. Avatar for Psych0Active 81. Psych0Active Lv 1 19 pts. 8,805
  2. Avatar for jobo0502 82. jobo0502 Lv 1 19 pts. 8,785
  3. Avatar for Cyberkashi 83. Cyberkashi Lv 1 18 pts. 8,765
  4. Avatar for Norrjane 84. Norrjane Lv 1 18 pts. 8,750
  5. Avatar for fishercat 85. fishercat Lv 1 18 pts. 8,743
  6. Avatar for dpmattingly 86. dpmattingly Lv 1 17 pts. 8,742
  7. Avatar for YeshuaLives 87. YeshuaLives Lv 1 17 pts. 8,731
  8. Avatar for tallguy-13088 88. tallguy-13088 Lv 1 16 pts. 8,722
  9. Avatar for phi16 89. phi16 Lv 1 16 pts. 8,718
  10. Avatar for caglar 90. caglar Lv 1 16 pts. 8,715

Comments