Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups


  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 5,417
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,339
  3. Avatar for MB109 24. MB109 1 pt. 0
  4. Avatar for Window Group 25. Window Group 1 pt. 0

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,364
  2. Avatar for MaartenDesnouck 2. MaartenDesnouck Lv 1 90 pts. 9,361
  3. Avatar for gmn 3. gmn Lv 1 80 pts. 9,361
  4. Avatar for mimi 4. mimi Lv 1 71 pts. 9,360
  5. Avatar for lamoille 5. lamoille Lv 1 63 pts. 9,360
  6. Avatar for gitwut 6. gitwut Lv 1 55 pts. 9,359
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 49 pts. 9,358
  8. Avatar for Blipperman 8. Blipperman Lv 1 43 pts. 9,352
  9. Avatar for grogar7 9. grogar7 Lv 1 37 pts. 9,347
  10. Avatar for actiasluna 10. actiasluna Lv 1 32 pts. 9,346

Comments