Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 5,417
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,339
  3. Avatar for Applied Science - Fold It 23. Applied Science - Fold It 1 pt. 5,130
  4. Avatar for MB109 24. MB109 1 pt. 0
  5. Avatar for Window Group 25. Window Group 1 pt. 0
  1. Avatar for kobasabu 191. kobasabu Lv 1 1 pt. 7,613
  2. Avatar for Lucas-T 192. Lucas-T Lv 1 1 pt. 7,607
  3. Avatar for all42 193. all42 Lv 1 1 pt. 7,599
  4. Avatar for isantheautumn 194. isantheautumn Lv 1 1 pt. 7,589
  5. Avatar for kodi4444 195. kodi4444 Lv 1 1 pt. 7,551
  6. Avatar for tela 196. tela Lv 1 1 pt. 7,541
  7. Avatar for Already taken 197. Already taken Lv 1 1 pt. 7,526
  8. Avatar for BillNye769 198. BillNye769 Lv 1 1 pt. 7,501
  9. Avatar for jamiexq 199. jamiexq Lv 1 1 pt. 7,498
  10. Avatar for Leronei 200. Leronei Lv 1 1 pt. 7,463

Comments