Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 5,417
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,339
  3. Avatar for Applied Science - Fold It 23. Applied Science - Fold It 1 pt. 5,130
  4. Avatar for MB109 24. MB109 1 pt. 0
  5. Avatar for Window Group 25. Window Group 1 pt. 0
  1. Avatar for BirS 211. BirS Lv 1 1 pt. 7,325
  2. Avatar for blackhoofs 212. blackhoofs Lv 1 1 pt. 7,292
  3. Avatar for bunkhead 213. bunkhead Lv 1 1 pt. 7,225
  4. Avatar for Primalsoul 214. Primalsoul Lv 1 1 pt. 7,215
  5. Avatar for ayelet70 215. ayelet70 Lv 1 1 pt. 7,168
  6. Avatar for guiltyflame 216. guiltyflame Lv 1 1 pt. 7,156
  7. Avatar for Radeodem8 217. Radeodem8 Lv 1 1 pt. 7,085
  8. Avatar for Ciccillo 218. Ciccillo Lv 1 1 pt. 7,051
  9. Avatar for Liebert 219. Liebert Lv 1 1 pt. 7,050
  10. Avatar for JXPZ 220. JXPZ Lv 1 1 pt. 7,028

Comments