Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 5,417
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,339
  3. Avatar for Applied Science - Fold It 23. Applied Science - Fold It 1 pt. 5,130
  4. Avatar for MB109 24. MB109 1 pt. 0
  5. Avatar for Window Group 25. Window Group 1 pt. 0
  1. Avatar for Wheeler22 221. Wheeler22 Lv 1 1 pt. 6,970
  2. Avatar for Close At Hand 222. Close At Hand Lv 1 1 pt. 6,953
  3. Avatar for penteplayer 223. penteplayer Lv 1 1 pt. 6,914
  4. Avatar for Physott 224. Physott Lv 1 1 pt. 6,913
  5. Avatar for girltano 225. girltano Lv 1 1 pt. 6,754
  6. Avatar for javila 226. javila Lv 1 1 pt. 6,711
  7. Avatar for Ronin-Sensei 227. Ronin-Sensei Lv 1 1 pt. 6,706
  8. Avatar for Technocoder 228. Technocoder Lv 1 1 pt. 6,693
  9. Avatar for FreeFolder 229. FreeFolder Lv 1 1 pt. 6,654
  10. Avatar for csowens0 230. csowens0 Lv 1 1 pt. 6,522

Comments