Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 5,417
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,339
  3. Avatar for Applied Science - Fold It 23. Applied Science - Fold It 1 pt. 5,130
  4. Avatar for MB109 24. MB109 1 pt. 0
  5. Avatar for Window Group 25. Window Group 1 pt. 0
  1. Avatar for dcrwheeler 61. dcrwheeler Lv 1 31 pts. 8,948
  2. Avatar for TurtleByte 62. TurtleByte Lv 1 30 pts. 8,908
  3. Avatar for Bletchley Park 63. Bletchley Park Lv 1 29 pts. 8,905
  4. Avatar for alcor29 64. alcor29 Lv 1 29 pts. 8,901
  5. Avatar for crpainter 65. crpainter Lv 1 28 pts. 8,896
  6. Avatar for YGK 66. YGK Lv 1 27 pts. 8,882
  7. Avatar for froggs554 67. froggs554 Lv 1 27 pts. 8,881
  8. Avatar for Bautho 68. Bautho Lv 1 26 pts. 8,875
  9. Avatar for Glen B 69. Glen B Lv 1 26 pts. 8,862
  10. Avatar for harvardman 70. harvardman Lv 1 25 pts. 8,862

Comments