Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850
  1. Avatar for jermainiac 21. jermainiac Lv 1 5 pts. 9,289
  2. Avatar for LociOiling 22. LociOiling Lv 1 4 pts. 9,288
  3. Avatar for smilingone 23. smilingone Lv 1 4 pts. 9,284
  4. Avatar for diamond_dust 24. diamond_dust Lv 1 3 pts. 9,282
  5. Avatar for reefyrob 25. reefyrob Lv 1 2 pts. 9,281
  6. Avatar for gloverd 26. gloverd Lv 1 2 pts. 9,281
  7. Avatar for O Seki To 27. O Seki To Lv 1 2 pts. 9,281
  8. Avatar for egran48 28. egran48 Lv 1 1 pt. 9,280
  9. Avatar for Bruno Kestemont 29. Bruno Kestemont Lv 1 1 pt. 9,280
  10. Avatar for phi16 30. phi16 Lv 1 1 pt. 9,277

Comments