Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850
  1. Avatar for alwen 31. alwen Lv 1 1 pt. 9,277
  2. Avatar for nemo7731 32. nemo7731 Lv 1 1 pt. 9,276
  3. Avatar for Deleted player 33. Deleted player pts. 9,273
  4. Avatar for retiredmichael 34. retiredmichael Lv 1 1 pt. 9,273
  5. Avatar for mirp 35. mirp Lv 1 1 pt. 9,272
  6. Avatar for brgreening 36. brgreening Lv 1 1 pt. 9,271
  7. Avatar for bertro 37. bertro Lv 1 1 pt. 9,260
  8. Avatar for martin.szew 38. martin.szew Lv 1 1 pt. 9,258
  9. Avatar for hansvandenhof 39. hansvandenhof Lv 1 1 pt. 9,242
  10. Avatar for ViJay7019 40. ViJay7019 Lv 1 1 pt. 9,215

Comments