Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850

  1. Avatar for dbuske 131. dbuske Lv 1 5 pts. 8,359
  2. Avatar for gardenpea 132. gardenpea Lv 1 5 pts. 8,358
  3. Avatar for Deleted player 133. Deleted player pts. 8,320
  4. Avatar for jon_gold 134. jon_gold Lv 1 5 pts. 8,298
  5. Avatar for mitarcher 135. mitarcher Lv 1 4 pts. 8,265
  6. Avatar for pandapharmd 136. pandapharmd Lv 1 4 pts. 8,263
  7. Avatar for NotJim99 137. NotJim99 Lv 1 4 pts. 8,262
  8. Avatar for Truncheon Luncheon 138. Truncheon Luncheon Lv 1 4 pts. 8,255
  9. Avatar for Pro Lapser 139. Pro Lapser Lv 1 4 pts. 8,242
  10. Avatar for Festering Wounds 140. Festering Wounds Lv 1 4 pts. 8,238

Comments