Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850

  1. Avatar for Psych0Active 81. Psych0Active Lv 1 19 pts. 8,805
  2. Avatar for jobo0502 82. jobo0502 Lv 1 19 pts. 8,785
  3. Avatar for Cyberkashi 83. Cyberkashi Lv 1 18 pts. 8,765
  4. Avatar for Norrjane 84. Norrjane Lv 1 18 pts. 8,750
  5. Avatar for fishercat 85. fishercat Lv 1 18 pts. 8,743
  6. Avatar for dpmattingly 86. dpmattingly Lv 1 17 pts. 8,742
  7. Avatar for YeshuaLives 87. YeshuaLives Lv 1 17 pts. 8,731
  8. Avatar for tallguy-13088 88. tallguy-13088 Lv 1 16 pts. 8,722
  9. Avatar for phi16 89. phi16 Lv 1 16 pts. 8,718
  10. Avatar for caglar 90. caglar Lv 1 16 pts. 8,715

Comments