Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850
  1. Avatar for GRandall64 261. GRandall64 Lv 1 1 pt. 5,130
  2. Avatar for JeErb15 262. JeErb15 Lv 1 1 pt. 5,130
  3. Avatar for 01010011111 263. 01010011111 Lv 1 1 pt. 5,018
  4. Avatar for Dracogenius 264. Dracogenius Lv 1 1 pt. 4,165
  5. Avatar for VespucciDude 265. VespucciDude Lv 1 1 pt. 2,230
  6. Avatar for daito 266. daito Lv 1 1 pt. 538
  7. Avatar for CloudTheWolf 267. CloudTheWolf Lv 1 1 pt. 0
  8. Avatar for dettingen 268. dettingen Lv 1 1 pt. 0
  9. Avatar for zkm 269. zkm Lv 1 1 pt. 0
  10. Avatar for brooney6366 270. brooney6366 Lv 1 1 pt. 0

Comments