Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,259
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,222
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,108
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,942
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,865
  6. Avatar for Deleted group 16. Deleted group pts. 8,780
  7. Avatar for Applied Science - Fold It 17. Applied Science - Fold It 1 pt. 8,552
  8. Avatar for freefolder 18. freefolder 1 pt. 8,519
  9. Avatar for Deleted group 19. Deleted group pts. 8,469
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,421
  1. Avatar for gloverd
    1. gloverd Lv 1
    100 pts. 9,610
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 88 pts. 9,607
  3. Avatar for diamond_dust 3. diamond_dust Lv 1 77 pts. 9,602
  4. Avatar for Paulo Roque 4. Paulo Roque Lv 1 68 pts. 9,600
  5. Avatar for pauldunn 5. pauldunn Lv 1 59 pts. 9,596
  6. Avatar for mirp 6. mirp Lv 1 51 pts. 9,594
  7. Avatar for LociOiling 7. LociOiling Lv 1 44 pts. 9,578
  8. Avatar for reefyrob 8. reefyrob Lv 1 38 pts. 9,577
  9. Avatar for smilingone 9. smilingone Lv 1 32 pts. 9,576
  10. Avatar for Deleted player 10. Deleted player 27 pts. 9,568

Comments