Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for xkcd 11. xkcd 5 pts. 9,259
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,222
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,108
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,942
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,865
  6. Avatar for Deleted group 16. Deleted group pts. 8,780
  7. Avatar for freefolder 18. freefolder 1 pt. 8,519
  8. Avatar for Deleted group 19. Deleted group pts. 8,469
  9. Avatar for CureCoin 20. CureCoin 1 pt. 8,421

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 9,602
  2. Avatar for Deleted player 2. Deleted player 99 pts. 9,575
  3. Avatar for mirp 3. mirp Lv 1 97 pts. 9,566
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 95 pts. 9,555
  5. Avatar for LociOiling 5. LociOiling Lv 1 93 pts. 9,552
  6. Avatar for gmn 6. gmn Lv 1 91 pts. 9,547
  7. Avatar for mimi 7. mimi Lv 1 89 pts. 9,546
  8. Avatar for pauldunn 8. pauldunn Lv 1 87 pts. 9,545
  9. Avatar for BitSpawn 9. BitSpawn Lv 1 86 pts. 9,544
  10. Avatar for O Seki To 10. O Seki To Lv 1 84 pts. 9,526

Comments