Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,259
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,222
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,108
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,942
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,865
  6. Avatar for Deleted group 16. Deleted group pts. 8,780
  7. Avatar for Applied Science - Fold It 17. Applied Science - Fold It 1 pt. 8,552
  8. Avatar for freefolder 18. freefolder 1 pt. 8,519
  9. Avatar for Deleted group 19. Deleted group pts. 8,469
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,421
  1. Avatar for abiogenesis 101. abiogenesis Lv 1 9 pts. 9,193
  2. Avatar for manu8170 102. manu8170 Lv 1 8 pts. 9,188
  3. Avatar for Scopper 103. Scopper Lv 1 8 pts. 9,173
  4. Avatar for mitarcher 104. mitarcher Lv 1 8 pts. 9,167
  5. Avatar for zo3xiaJonWeinberg 105. zo3xiaJonWeinberg Lv 1 8 pts. 9,165
  6. Avatar for dahast.de 106. dahast.de Lv 1 7 pts. 9,163
  7. Avatar for rezaefar 107. rezaefar Lv 1 7 pts. 9,158
  8. Avatar for bamh 108. bamh Lv 1 7 pts. 9,150
  9. Avatar for weitzen 109. weitzen Lv 1 7 pts. 9,147
  10. Avatar for johngran 110. johngran Lv 1 7 pts. 9,141

Comments