Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,259
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,222
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,108
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,942
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,865
  6. Avatar for Deleted group 16. Deleted group pts. 8,780
  7. Avatar for Applied Science - Fold It 17. Applied Science - Fold It 1 pt. 8,552
  8. Avatar for freefolder 18. freefolder 1 pt. 8,519
  9. Avatar for Deleted group 19. Deleted group pts. 8,469
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,421
  1. Avatar for Petrifolder 111. Petrifolder Lv 1 6 pts. 9,141
  2. Avatar for jamiexq 112. jamiexq Lv 1 6 pts. 9,137
  3. Avatar for ncameron 113. ncameron Lv 1 6 pts. 9,135
  4. Avatar for DaMaxl 114. DaMaxl Lv 1 6 pts. 9,127
  5. Avatar for jebbiek 115. jebbiek Lv 1 6 pts. 9,124
  6. Avatar for DScott 116. DScott Lv 1 5 pts. 9,121
  7. Avatar for pfirth 117. pfirth Lv 1 5 pts. 9,120
  8. Avatar for egran48 118. egran48 Lv 1 5 pts. 9,115
  9. Avatar for val.sch67 119. val.sch67 Lv 1 5 pts. 9,113
  10. Avatar for navn 120. navn Lv 1 5 pts. 9,113

Comments