Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for xkcd 11. xkcd 5 pts. 9,259
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,222
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,108
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,942
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,865
  6. Avatar for Deleted group 16. Deleted group pts. 8,780
  7. Avatar for freefolder 18. freefolder 1 pt. 8,519
  8. Avatar for Deleted group 19. Deleted group pts. 8,469
  9. Avatar for CureCoin 20. CureCoin 1 pt. 8,421

  1. Avatar for caglar 131. caglar Lv 1 3 pts. 9,095
  2. Avatar for pizpot 132. pizpot Lv 1 3 pts. 9,091
  3. Avatar for Satina 133. Satina Lv 1 3 pts. 9,090
  4. Avatar for tela 134. tela Lv 1 3 pts. 9,090
  5. Avatar for andrewxc 135. andrewxc Lv 1 3 pts. 9,088
  6. Avatar for cherry39 136. cherry39 Lv 1 3 pts. 9,081
  7. Avatar for ecali 137. ecali Lv 1 3 pts. 9,072
  8. Avatar for DAMilwaukeeWisconsin 138. DAMilwaukeeWisconsin Lv 1 3 pts. 9,066
  9. Avatar for Jajaboman 139. Jajaboman Lv 1 2 pts. 9,057
  10. Avatar for tallguy-13088 140. tallguy-13088 Lv 1 2 pts. 9,036

Comments