Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,259
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,222
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,108
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,942
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,865
  6. Avatar for Deleted group 16. Deleted group pts. 8,780
  7. Avatar for Applied Science - Fold It 17. Applied Science - Fold It 1 pt. 8,552
  8. Avatar for freefolder 18. freefolder 1 pt. 8,519
  9. Avatar for Deleted group 19. Deleted group pts. 8,469
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,421
  1. Avatar for mirjamvandelft 141. mirjamvandelft Lv 1 2 pts. 9,027
  2. Avatar for ppp6 142. ppp6 Lv 1 2 pts. 9,008
  3. Avatar for phi16 143. phi16 Lv 1 2 pts. 9,008
  4. Avatar for cinnamonkitty 144. cinnamonkitty Lv 1 2 pts. 9,000
  5. Avatar for ManVsYard 145. ManVsYard Lv 1 2 pts. 8,987
  6. Avatar for Iron pet 146. Iron pet Lv 1 2 pts. 8,986
  7. Avatar for Incongruous 147. Incongruous Lv 1 2 pts. 8,947
  8. Avatar for averagebeverage 148. averagebeverage Lv 1 2 pts. 8,944
  9. Avatar for Mr_Jolty 149. Mr_Jolty Lv 1 2 pts. 8,942
  10. Avatar for awesome54 150. awesome54 Lv 1 2 pts. 8,940

Comments