Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,259
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,222
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,108
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,942
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,865
  6. Avatar for Deleted group 16. Deleted group pts. 8,780
  7. Avatar for Applied Science - Fold It 17. Applied Science - Fold It 1 pt. 8,552
  8. Avatar for freefolder 18. freefolder 1 pt. 8,519
  9. Avatar for Deleted group 19. Deleted group pts. 8,469
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,421
  1. Avatar for girltano 151. girltano Lv 1 2 pts. 8,918
  2. Avatar for SouperGenious 152. SouperGenious Lv 1 2 pts. 8,914
  3. Avatar for GreekCivilization 153. GreekCivilization Lv 1 2 pts. 8,901
  4. Avatar for Datstandin 154. Datstandin Lv 1 1 pt. 8,897
  5. Avatar for NotJim99 155. NotJim99 Lv 1 1 pt. 8,897
  6. Avatar for TJOK fan 156. TJOK fan Lv 1 1 pt. 8,892
  7. Avatar for raflyirham 157. raflyirham Lv 1 1 pt. 8,877
  8. Avatar for Soggy Doglog 158. Soggy Doglog Lv 1 1 pt. 8,872
  9. Avatar for PrettyPony2001 159. PrettyPony2001 Lv 1 1 pt. 8,872
  10. Avatar for rws 160. rws Lv 1 1 pt. 8,865

Comments