Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,259
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,222
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,108
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,942
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,865
  6. Avatar for Deleted group 16. Deleted group pts. 8,780
  7. Avatar for Applied Science - Fold It 17. Applied Science - Fold It 1 pt. 8,552
  8. Avatar for freefolder 18. freefolder 1 pt. 8,519
  9. Avatar for Deleted group 19. Deleted group pts. 8,469
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,421
  1. Avatar for martinf 161. martinf Lv 1 1 pt. 8,861
  2. Avatar for Truncheon Luncheon 162. Truncheon Luncheon Lv 1 1 pt. 8,858
  3. Avatar for dstefanescu 163. dstefanescu Lv 1 1 pt. 8,851
  4. Avatar for lamoille 164. lamoille Lv 1 1 pt. 8,846
  5. Avatar for Auntecedent 165. Auntecedent Lv 1 1 pt. 8,842
  6. Avatar for Ronin-Sensei 166. Ronin-Sensei Lv 1 1 pt. 8,842
  7. Avatar for Mydogisa Toelicker 167. Mydogisa Toelicker Lv 1 1 pt. 8,840
  8. Avatar for Colostomy EXPLOSION. 168. Colostomy EXPLOSION. Lv 1 1 pt. 8,826
  9. Avatar for Czim 169. Czim Lv 1 1 pt. 8,823
  10. Avatar for Silhouette 170. Silhouette Lv 1 1 pt. 8,816

Comments