Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,259
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,222
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,108
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,942
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,865
  6. Avatar for Deleted group 16. Deleted group pts. 8,780
  7. Avatar for Applied Science - Fold It 17. Applied Science - Fold It 1 pt. 8,552
  8. Avatar for freefolder 18. freefolder 1 pt. 8,519
  9. Avatar for Deleted group 19. Deleted group pts. 8,469
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,421
  1. Avatar for FreeFolder 201. FreeFolder Lv 1 1 pt. 8,573
  2. Avatar for Mykyta 202. Mykyta Lv 1 1 pt. 8,566
  3. Avatar for artem_a 203. artem_a Lv 1 1 pt. 8,561
  4. Avatar for TrBut15 204. TrBut15 Lv 1 1 pt. 8,552
  5. Avatar for pmelzer 205. pmelzer Lv 1 1 pt. 8,530
  6. Avatar for Altercomp 206. Altercomp Lv 1 1 pt. 8,519
  7. Avatar for rtw599 207. rtw599 Lv 1 1 pt. 8,515
  8. Avatar for Belle36 208. Belle36 Lv 1 1 pt. 8,513
  9. Avatar for BirS 209. BirS Lv 1 1 pt. 8,501
  10. Avatar for momadoc 210. momadoc Lv 1 1 pt. 8,498

Comments