Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for xkcd 11. xkcd 5 pts. 9,259
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,222
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,108
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,942
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,865
  6. Avatar for Deleted group 16. Deleted group pts. 8,780
  7. Avatar for freefolder 18. freefolder 1 pt. 8,519
  8. Avatar for Deleted group 19. Deleted group pts. 8,469
  9. Avatar for CureCoin 20. CureCoin 1 pt. 8,421

  1. Avatar for Melek. 221. Melek. Lv 1 1 pt. 8,448
  2. Avatar for dawiha 223. dawiha Lv 1 1 pt. 8,446
  3. Avatar for ivalnic 224. ivalnic Lv 1 1 pt. 8,443
  4. Avatar for theonlyperuvian 225. theonlyperuvian Lv 1 1 pt. 8,437
  5. Avatar for trentis1 226. trentis1 Lv 1 1 pt. 8,428
  6. Avatar for Lindata 227. Lindata Lv 1 1 pt. 8,426
  7. Avatar for smarthuman 228. smarthuman Lv 1 1 pt. 8,421
  8. Avatar for Leong12 229. Leong12 Lv 1 1 pt. 8,413
  9. Avatar for kncrissinger0 230. kncrissinger0 Lv 1 1 pt. 8,400

Comments