Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,259
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,222
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,108
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,942
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,865
  6. Avatar for Deleted group 16. Deleted group pts. 8,780
  7. Avatar for Applied Science - Fold It 17. Applied Science - Fold It 1 pt. 8,552
  8. Avatar for freefolder 18. freefolder 1 pt. 8,519
  9. Avatar for Deleted group 19. Deleted group pts. 8,469
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,421
  1. Avatar for Norrjane 41. Norrjane Lv 1 43 pts. 9,421
  2. Avatar for fpc 42. fpc Lv 1 42 pts. 9,419
  3. Avatar for LagMasterSam 43. LagMasterSam Lv 1 41 pts. 9,408
  4. Avatar for pmthomson90 44. pmthomson90 Lv 1 40 pts. 9,406
  5. Avatar for nemo7731 45. nemo7731 Lv 1 39 pts. 9,404
  6. Avatar for Jim Fraser 46. Jim Fraser Lv 1 38 pts. 9,403
  7. Avatar for strong_base 47. strong_base Lv 1 37 pts. 9,397
  8. Avatar for silverberg 48. silverberg Lv 1 36 pts. 9,396
  9. Avatar for fishercat 49. fishercat Lv 1 36 pts. 9,384
  10. Avatar for SKSbell 50. SKSbell Lv 1 35 pts. 9,382

Comments