Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for xkcd 11. xkcd 5 pts. 9,259
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,222
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,108
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,942
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,865
  6. Avatar for Deleted group 16. Deleted group pts. 8,780
  7. Avatar for freefolder 18. freefolder 1 pt. 8,519
  8. Avatar for Deleted group 19. Deleted group pts. 8,469
  9. Avatar for CureCoin 20. CureCoin 1 pt. 8,421

  1. Avatar for MaartenDesnouck 61. MaartenDesnouck Lv 1 26 pts. 9,357
  2. Avatar for Merf 62. Merf Lv 1 26 pts. 9,354
  3. Avatar for khalan86 63. khalan86 Lv 1 25 pts. 9,348
  4. Avatar for cobaltteal 64. cobaltteal Lv 1 25 pts. 9,345
  5. Avatar for Vinara 65. Vinara Lv 1 24 pts. 9,339
  6. Avatar for dcrwheeler 66. dcrwheeler Lv 1 23 pts. 9,337
  7. Avatar for gurch 67. gurch Lv 1 23 pts. 9,336
  8. Avatar for steveB 68. steveB Lv 1 22 pts. 9,330
  9. Avatar for arginia 69. arginia Lv 1 22 pts. 9,324
  10. Avatar for JUMELLE54 70. JUMELLE54 Lv 1 21 pts. 9,308

Comments