Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,400
  2. Avatar for Ms. Carter's Jr. Science Classes 22. Ms. Carter's Jr. Science Classes 1 pt. 8,260
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,058
  1. Avatar for gloverd
    1. gloverd Lv 1
    100 pts. 9,610
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 88 pts. 9,607
  3. Avatar for diamond_dust 3. diamond_dust Lv 1 77 pts. 9,602
  4. Avatar for Paulo Roque 4. Paulo Roque Lv 1 68 pts. 9,600
  5. Avatar for pauldunn 5. pauldunn Lv 1 59 pts. 9,596
  6. Avatar for mirp 6. mirp Lv 1 51 pts. 9,594
  7. Avatar for LociOiling 7. LociOiling Lv 1 44 pts. 9,578
  8. Avatar for reefyrob 8. reefyrob Lv 1 38 pts. 9,577
  9. Avatar for smilingone 9. smilingone Lv 1 32 pts. 9,576
  10. Avatar for Deleted player 10. Deleted player 27 pts. 9,568

Comments