Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,400
  2. Avatar for Ms. Carter's Jr. Science Classes 22. Ms. Carter's Jr. Science Classes 1 pt. 8,260
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,058
  1. Avatar for RyeSnake 91. RyeSnake Lv 1 12 pts. 9,233
  2. Avatar for Glen B 92. Glen B Lv 1 11 pts. 9,227
  3. Avatar for ViJay7019 93. ViJay7019 Lv 1 11 pts. 9,224
  4. Avatar for YeshuaLives 94. YeshuaLives Lv 1 11 pts. 9,222
  5. Avatar for kitek314_pl 95. kitek314_pl Lv 1 10 pts. 9,222
  6. Avatar for cbwest 96. cbwest Lv 1 10 pts. 9,219
  7. Avatar for hansvandenhof 97. hansvandenhof Lv 1 10 pts. 9,215
  8. Avatar for leehaggis 98. leehaggis Lv 1 10 pts. 9,214
  9. Avatar for amylindalou 99. amylindalou Lv 1 9 pts. 9,214
  10. Avatar for froggs554 100. froggs554 Lv 1 9 pts. 9,195

Comments