Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,400
  2. Avatar for Ms. Carter's Jr. Science Classes 22. Ms. Carter's Jr. Science Classes 1 pt. 8,260
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,058
  1. Avatar for senor pit 121. senor pit Lv 1 5 pts. 9,112
  2. Avatar for Deleted player 122. Deleted player pts. 9,112
  3. Avatar for pandapharmd 123. pandapharmd Lv 1 4 pts. 9,111
  4. Avatar for molleke 124. molleke Lv 1 4 pts. 9,108
  5. Avatar for isaksson 125. isaksson Lv 1 4 pts. 9,107
  6. Avatar for justjustin 126. justjustin Lv 1 4 pts. 9,105
  7. Avatar for Maru67 127. Maru67 Lv 1 4 pts. 9,099
  8. Avatar for bob1928 128. bob1928 Lv 1 4 pts. 9,097
  9. Avatar for bwkittitas 129. bwkittitas Lv 1 4 pts. 9,096
  10. Avatar for Psych0Active 130. Psych0Active Lv 1 3 pts. 9,095

Comments