Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,400
  2. Avatar for Ms. Carter's Jr. Science Classes 22. Ms. Carter's Jr. Science Classes 1 pt. 8,260
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,058
  1. Avatar for mirjamvandelft 141. mirjamvandelft Lv 1 2 pts. 9,027
  2. Avatar for ppp6 142. ppp6 Lv 1 2 pts. 9,008
  3. Avatar for phi16 143. phi16 Lv 1 2 pts. 9,008
  4. Avatar for cinnamonkitty 144. cinnamonkitty Lv 1 2 pts. 9,000
  5. Avatar for ManVsYard 145. ManVsYard Lv 1 2 pts. 8,987
  6. Avatar for Iron pet 146. Iron pet Lv 1 2 pts. 8,986
  7. Avatar for Incongruous 147. Incongruous Lv 1 2 pts. 8,947
  8. Avatar for averagebeverage 148. averagebeverage Lv 1 2 pts. 8,944
  9. Avatar for Mr_Jolty 149. Mr_Jolty Lv 1 2 pts. 8,942
  10. Avatar for awesome54 150. awesome54 Lv 1 2 pts. 8,940

Comments