Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,400
  2. Avatar for Ms. Carter's Jr. Science Classes 22. Ms. Carter's Jr. Science Classes 1 pt. 8,260
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,058
  1. Avatar for Radeodem8 171. Radeodem8 Lv 1 1 pt. 8,801
  2. Avatar for rappie 172. rappie Lv 1 1 pt. 8,791
  3. Avatar for Pibeagles 173. Pibeagles Lv 1 1 pt. 8,791
  4. Avatar for Inkedhands 174. Inkedhands Lv 1 1 pt. 8,787
  5. Avatar for Amphimixus 175. Amphimixus Lv 1 1 pt. 8,780
  6. Avatar for kerpowah 176. kerpowah Lv 1 1 pt. 8,772
  7. Avatar for NameChangeNeeded01 177. NameChangeNeeded01 Lv 1 1 pt. 8,758
  8. Avatar for JackONeill12 178. JackONeill12 Lv 1 1 pt. 8,756
  9. Avatar for franse 179. franse Lv 1 1 pt. 8,748
  10. Avatar for joui31 180. joui31 Lv 1 1 pt. 8,742

Comments