Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,400
  2. Avatar for Ms. Carter's Jr. Science Classes 22. Ms. Carter's Jr. Science Classes 1 pt. 8,260
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,058
  1. Avatar for Arne Heessels 181. Arne Heessels Lv 1 1 pt. 8,740
  2. Avatar for Simek 182. Simek Lv 1 1 pt. 8,734
  3. Avatar for lacie 183. lacie Lv 1 1 pt. 8,728
  4. Avatar for pandabearsecond 184. pandabearsecond Lv 1 1 pt. 8,694
  5. Avatar for 01010011111 185. 01010011111 Lv 1 1 pt. 8,689
  6. Avatar for Restartbob 186. Restartbob Lv 1 1 pt. 8,687
  7. Avatar for will2216 187. will2216 Lv 1 1 pt. 8,685
  8. Avatar for bhodg1 188. bhodg1 Lv 1 1 pt. 8,684
  9. Avatar for Close At Hand 189. Close At Hand Lv 1 1 pt. 8,671
  10. Avatar for admsuu 190. admsuu Lv 1 1 pt. 8,655

Comments