Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,400
  2. Avatar for Ms. Carter's Jr. Science Classes 22. Ms. Carter's Jr. Science Classes 1 pt. 8,260
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,058
  1. Avatar for frood66 11. frood66 Lv 1 82 pts. 9,525
  2. Avatar for Deleted player 12. Deleted player pts. 9,517
  3. Avatar for grogar7 13. grogar7 Lv 1 79 pts. 9,516
  4. Avatar for KarenCH 14. KarenCH Lv 1 77 pts. 9,514
  5. Avatar for actiasluna 15. actiasluna Lv 1 76 pts. 9,513
  6. Avatar for nicobul 16. nicobul Lv 1 74 pts. 9,500
  7. Avatar for Museka 17. Museka Lv 1 73 pts. 9,499
  8. Avatar for gitwut 18. gitwut Lv 1 71 pts. 9,499
  9. Avatar for gloverd 19. gloverd Lv 1 70 pts. 9,498
  10. Avatar for bertro 20. bertro Lv 1 68 pts. 9,491

Comments