Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,400
  2. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,058

  1. Avatar for foldit04 191. foldit04 Lv 1 1 pt. 8,650
  2. Avatar for Pro Lapser 192. Pro Lapser Lv 1 1 pt. 8,647
  3. Avatar for BrKapr 193. BrKapr Lv 1 1 pt. 8,626
  4. Avatar for penteplayer 194. penteplayer Lv 1 1 pt. 8,614
  5. Avatar for isantheautumn 195. isantheautumn Lv 1 1 pt. 8,613
  6. Avatar for all42 196. all42 Lv 1 1 pt. 8,612
  7. Avatar for Wheeler22 197. Wheeler22 Lv 1 1 pt. 8,609
  8. Avatar for trebach 198. trebach Lv 1 1 pt. 8,608
  9. Avatar for lightnir 199. lightnir Lv 1 1 pt. 8,600
  10. Avatar for drumpeter18yrs9yrs 200. drumpeter18yrs9yrs Lv 1 1 pt. 8,574

Comments