Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,400
  2. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,058

  1. Avatar for JeErb15 211. JeErb15 Lv 1 1 pt. 8,498
  2. Avatar for Tac1 212. Tac1 Lv 1 1 pt. 8,493
  3. Avatar for MaHut15 213. MaHut15 Lv 1 1 pt. 8,486
  4. Avatar for LucasPetitqueux 214. LucasPetitqueux Lv 1 1 pt. 8,483
  5. Avatar for clearminded_misfit 215. clearminded_misfit Lv 1 1 pt. 8,480
  6. Avatar for jussn 216. jussn Lv 1 1 pt. 8,478
  7. Avatar for zkhumphr 217. zkhumphr Lv 1 1 pt. 8,469
  8. Avatar for Tsskyx 218. Tsskyx Lv 1 1 pt. 8,467
  9. Avatar for Noririnm 219. Noririnm Lv 1 1 pt. 8,460
  10. Avatar for MacThomson 220. MacThomson Lv 1 1 pt. 8,453

Comments